PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08793.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 1084aa    MW: 119487 Da    PI: 4.856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08793.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-183985148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT+eEde+l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
  mrna08793.1-v1.0-hybrid 39 KGQWTPEEDEILRRAVQSFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 85
                             799****************************9.************986 PP

2Myb_DNA-binding66.54.9e-2191137148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+W++eEde++v++v+++G++ W+tIa++++ gR +kqc++rw+++l
  mrna08793.1-v1.0-hybrid  91 KGPWSKEEDEIIVELVEKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 137
                              79******************************.*************97 PP

3Myb_DNA-binding48.12.6e-15143185145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
  mrna08793.1-v1.0-hybrid 143 KEAWTQEEELALIRAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 185
                              579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2053485IPR017930Myb domain
SMARTSM007171.5E-153887IPR001005SANT/Myb domain
PfamPF002497.5E-163985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-224097IPR009057Homeodomain-like
SuperFamilySSF466891.15E-154095IPR009057Homeodomain-like
CDDcd001674.03E-144285No hitNo description
PROSITE profilePS5129434.28986141IPR017930Myb domain
SuperFamilySSF466894.12E-3288184IPR009057Homeodomain-like
SMARTSM007178.5E-2090139IPR001005SANT/Myb domain
PfamPF002493.4E-1991137IPR001005SANT/Myb domain
CDDcd001672.25E-1793137No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2898145IPR009057Homeodomain-like
PROSITE profilePS5129419.513142192IPR017930Myb domain
SMARTSM007176.3E-15142190IPR001005SANT/Myb domain
PfamPF002492.2E-13143186IPR001005SANT/Myb domain
CDDcd001671.27E-11145185No hitNo description
Gene3DG3DSA:1.10.10.602.1E-21146192IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1084 aa     Download sequence    Send to blast
MDGDKNSYTP TPAGPGSSSL QRTRTSHGRS SGPTRRSTKG QWTPEEDEIL RRAVQSFKGK  60
NWKKIAECFK DRTDVQCLHR WQKVLNPELV KGPWSKEEDE IIVELVEKYG PKKWSTIAQH  120
LPGRIGKQCR ERWHNHLNPG INKEAWTQEE ELALIRAHQI YGNKWAELTK FLPGRTDNAI  180
KNHWNSSVKK KLDSYLKSGL LPDFEGTPHV GHQNQPIIAS CSRVQNSGDD SAPRGAEGEE  240
KSECSQDSTV AGGFQSATEM VNVVLNTRDR SHIREVSRLG NDPSSSPASC SEPYFPSMGD  300
ATFAIPEIPP ELVSSSKFIE QTFAHDAGEL MSGDFQFNMQ ELTNISSLES GQEASGMHTH  360
CMSSNEIHDV VNFPFQNASA FPASTSMENM VDGSIKSERM LISDDECCRA LFSEAINQGY  420
YFSREFTNGS SMVDLITCTE SFLQSSSNLQ LSETGRSSQP YCALNLDLVG TPCSQPVSAH  480
EGPLIFAGEP NHLFRVQVQE YVTSSEDAFV HTNDTARSPS TVGGNKTFMQ EQSHLVEDPL  540
DLVPVNTFDS GLDTQTSPAV DVRSDVHTEQ QDDRALCYEP PRFPSLDIPF LSCDLVQSGN  600
DMQQEYSPLG IRQLMMSSMN CLTPFRLWDS PSRDGSPDAV LKSAAKTFTG TPSILKKRHR  660
DLLSPLSPLS DRRIDKKLGT DVTSSLARDF SRLEVMFEAS ETQEAPSHSP SSNQPRDSDG  720
HEEAKENMDT CETRIEEGVD TDEIAQKNFD DSESPEKRKQ GNADVDTCET RIEEGVDTDE  780
IAQKIFDDSE SSEKRKQGND VDANTNAVPS SQDVQQSSGV LTEHNTNDLL LYSPDQAGCK  840
AEKALSLSAK TPKVQRSKSF SAKQGASVIT PTITVKKRES YLVAQTCTQS DSLSAPLETC  900
TNNAGNVACT ETMFGITPLK RSIDSPSAWK SPSAWKSPSA WKSPWFINSF LPGPRVDTEI  960
SIEDIGFFMS PGDRSYDAIG LMKQISEHTA SAYANAQEVL GNDTPESLLK QRRKDHDIMD  1020
LDNDLAPPDQ PGSSSLSAPN VMVERRTLDF SECGTPSKGK ESGKFSNTKT FSSPSSYLLK  1080
GCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C7e-69391926159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-69391926159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291202.20.0PREDICTED: myb-related protein 3R-1
TrEMBLM5XM690.0M5XM69_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein